Indonesia International Institute for Life Sciences - Learning Resources Center

  • Home
  • Information
  • News
  • Help
  • Librarian
  • Member Area
  • Select Language :
    Arabic Bengali Brazilian Portuguese English Espanol German Indonesian Japanese Malay Persian Russian Thai Turkish Urdu

Search by :

ALL Author Subject ISBN/ISSN Advanced Search

Last search:

{{tmpObj[k].text}}
No image available for this title
Bookmark Share

Thesis

Immunoinformatics Pipeline for Multi-Epitope Peptide Vaccine Design Based on the Nucleocapsid Phosphoprotein of Indonesian SARS-CoV-2 B.A.2 Isolates

Muhammad Aldino Hafidzhah - Personal Name;

COVID-19 were identified as viral diseases which was caused by the Severe Acute Respiratory
Syndrome Coronavirus type 2 (SARS-CoV-2). The SARS-CoV-2 are known to be the family of
coronaviridae. As we all know that patients that were infected by the COVID-19 has risen
significantly since the very early outbreak that happens in the early December 2019 specifically at
Wuhan, China. Researchers around the world are trying their best to find the best solution to
solve this pandemic. That’s why in this study, we will try to develop a new methodology in
designing vaccine for viral diseases especially the COVID-19. Therefore, this study aimed to design
a multi-epitope peptide based vaccine which utilizes the Nucleocapsid Phosphoprotein (N-
Protein) of the Indonesian B.A.2 Isolates. 34 SARS-CoV-2 isolates were obtained from the GISAID
Database and NCBI GenBank. These samples were used to examine the evolutionary relationship
of the SARS-CoV-2 through phylogenetic analysis and determine whether these nucleocapsid
proteins are well-conserved. The molecular docking approach is then used to visualize the
molecular interaction of the Toll-Like Receptors with the Vaccine Constructs. Based on the results
that had been acquired during the analysis process, it can be concluded that the Vaccine Construct
(GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAAKDQVILLNKHIDAYKTAAYLSPRWYFYYA
AYTPSGTWLTYAAYNTASWFTALAAYYYRRATRRIAAYKHWPQIAQFAAYFAPSASAFFGPGPGDQVILLNK
HIDAYKTGPGPGKDQVILLNKHIDAYKGPGPGFKDQVILLNKHIDAYGPGPGNFKDQVILLNKHIDAGPGPGK
DQVILLNKHIDAYKGPGPGFKDQVILLNKHIDAYGPGPGASAFFGMSRIGMEVTEAAAKGIGDPVTCLKSGAI
CHPVFCPRRYKQIGTCGLPGTKCCKKP) that was constructed base on the Isolates from Maluku might
be a potential vaccine construct candidate to develop a Multi-Epitope based Peptide Vaccine.


Availability
#
My Library (BI Thesis) BI 23-003
T202306034
Available
Detail Information
Series Title
-
Call Number
-
Publisher
i3L, Jakarta : i3L, Jakarta., 2023
Collation
-
Language
English
ISBN/ISSN
-
Classification
NONE
Content Type
-
Media Type
-
Carrier Type
-
Edition
-
Subject(s)
Bioinformatics
SARS-COV-2
vaccine design
Multi-Epitope
Nucleocapsid Phosphoprotein
COVID- 19
Specific Detail Info
-
Statement of Responsibility
-
Other version/related

No other version available

File Attachment
No Data
Comments

You must be logged in to post a comment

Indonesia International Institute for Life Sciences - Learning Resources Center
  • Information
  • Services
  • Librarian
  • Member Area

About Us

i3L Learning Resources Center (LRC) is vital part of your academic experience at Indonesia International Institute for Life-Sciences. LRC exists to support the teaching, learning and research programs of the Institute through the provision of high quality services and facilities which include access to a range of printed and digital resources primarily in the field of life-sciences and business. 

Search

start it by typing one or more keywords for title, author or subject

Keep SLiMS Alive Want to Contribute?

© 2025 — Senayan Developer Community

Powered by SLiMS
Select the topic you are interested in
  • Computer Science, Information & General Works
  • Philosophy & Psychology
  • Religion
  • Social Sciences
  • Language
  • Pure Science
  • Applied Sciences
  • Art & Recreation
  • Literature
  • History & Geography
Icons made by Freepik from www.flaticon.com
Advanced Search
Where do you want to share?